PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn320721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 640aa    MW: 72087.2 Da    PI: 7.0274
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn320721genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like62.95.9e-20235283251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 +r+rWtp+LH +F+ea++ L G +k+ Pk++l++m+ + Lt+ hv+SHLQ
  Achn320721 235 KRMRWTPDLHIKFMEAISFL-GDKKTHPKAVLKTMNEPALTVRHVASHLQ 283
                 7*******************.9**************************** PP

2Response_reg60.21.1e-20201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vd +++ +  ++++le + y +v++++ ++ al +++e +  +Dl++ D +m +md +++l +++ +  +lpii+++ h++ ++a +al+ Ga 
    Achn320721  20 VLVVDQDNVSLIYIASVLEGQFY-NVRTTELASVALSIIQEGKdeFDLVIADTDMGEMDIFTFLNRLQLKT-DLPIIFMSVHENIDLARKALNEGAC 114
                   89*********************.***************999999**********************9988.9************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                    fl Kp+ ++++++
    Achn320721 115 FFLQKPMRRRDIIN 128
                   *********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.9E-2616160No hitNo description
SuperFamilySSF521721.85E-2316146IPR011006CheY-like superfamily
SMARTSM004483.8E-1518130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011031.82519134IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.8E-1720128IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.15E-1821133No hitNo description
Gene3DG3DSA:1.10.10.601.7E-18232290IPR009057Homeodomain-like
SuperFamilySSF466893.58E-11234289IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-16235284IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MSGGNSENCF IPMAARGLRV LVVDQDNVSL IYIASVLEGQ FYNVRTTELA SVALSIIQEG  60
KDEFDLVIAD TDMGEMDIFT FLNRLQLKTD LPIIFMSVHE NIDLARKALN EGACFFLQKP  120
MRRRDIINVW QHVYRKRIIS QKIEIRRKAS TGKKVAIEKH SRGKRIVKVD NFSRVSVGNE  180
NLPKRKSPLT FSRITCAEKE NQGLSIRKSG DRSESDKSNS KGSEGKDRES GSPEKRMRWT  240
PDLHIKFMEA ISFLGDKKTH PKAVLKTMNE PALTVRHVAS HLQVSKNYMQ KKISIKYRDR  300
VQRINCANQK NDDPGKGGTT YNFYGGSGIY TGLLDRFNSM MNSTQGHHMT PNAEFGASMP  360
QFTSPVSLSS TGLNSGTSVH YNLETLKRAL NSGKLKRNRP SSSTNNFNAD NSCLNDTNPS  420
ANQKDDHQKL LEFDGSYNNF DYLGLEPDYS MHWTDMYQSL DPFGQKLNAP NNLFHQYPNY  480
QFSQETNFFQ GQTSTCPNSN NSFQNPNYQL GQETSFFQGQ TSTCPNSFQN PSYHLAQETG  540
FFQGQTSTLP DSNNFFQNPN YQLATESNAT QGLAAPTSTI SGVNENPSTS FADLWRLVEA  600
QEQLEGTNGE PNLEEEDDIE RYLEWFNGTP PESDNEIPK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1550856
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.19e-36response regulator 12